PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00677g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 301aa    MW: 34596.2 Da    PI: 7.9728
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00677g00011.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.72.7e-13134178347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+ E++l++ + +++G+g+Wk+I+r+    +t+ q+ s+ qky
  Peaxi162Scf00677g00011.1 134 PWTEGEHQLFLMGLNKYGKGDWKSISRYYVVSKTPTQIASHAQKY 178
                               7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.1463287IPR017884SANT domain
SMARTSM007170.373385IPR001005SANT/Myb domain
SuperFamilySSF466893.73E-73585IPR009057Homeodomain-like
PROSITE profilePS5129416.986126183IPR017930Myb domain
SuperFamilySSF466892.01E-15129183IPR009057Homeodomain-like
SMARTSM007171.4E-9131181IPR001005SANT/Myb domain
TIGRFAMsTIGR015575.9E-17132181IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.9E-9134179IPR009057Homeodomain-like
CDDcd001673.07E-9134179No hitNo description
PfamPF002495.8E-11134178IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MDWPEFLESS NSQESTFDLF SAPHINYGVV HEQANQWTLE EYQIFENALS HFNSNSPSFF  60
EYVSSKLPHK SLEDINNYYL ALLKEKAVAA ADHDDYDQLP QEEDSSYMEN VEAAMNGTQT  120
RDEKKGPRRR RGIPWTEGEH QLFLMGLNKY GKGDWKSISR YYVVSKTPTQ IASHAQKYFS  180
RRNSTTPLGR RRPSINDIQT VTLKPRTTTV TSRIKNSRLA NYNMNQGSSV PNFQYSYNFG  240
SMSSIHGDFG RFNRAEASSS SINMVQQTIN GNTINLHRPV SPRPFLSMYL SSHDPRNNYE  300
V
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009784767.11e-119PREDICTED: transcription factor DIVARICATA-like
TrEMBLK4BAA91e-78K4BAA9_SOLLC; Uncharacterized protein
STRINGSolyc02g082390.1.14e-78(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52342032
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-32MYB family protein